Immune Defense · commonly explored around immune response
LL-37
LL-37 is a germ-fighting peptide your own body makes. Animal studies show it kills bacteria and speeds wound healing, and a small human trial found faster healing of leg ulcers.
Informational profile
No verified OnimaChain inventory for this profile.
Also known as Cathelicidin LL-37 · hCAP18 (140-170)
- Sequence
- [LL-37, 37 aa]
- Length
- 37 residues
- MW
- 4493.33 Da computed
- Product tags
- antimicrobial · cathelicidin · amphipathic helix
- Checked sources
- No checked source added yet
- Structure provenance
- Sequence-derived illustration (not a measured structure) · Experimentally resolved (PDB 2K6O, 5NNM, 7PDC) — deposited, not rendered here
Video intro
LL-37 in ten seconds.
Coming soon.
Meet LL-37
The short version, before the deep dive.
LL-37 is a germ-fighting peptide your own body makes. Animal studies show it kills bacteria and speeds wound healing, and a small human trial found faster healing of leg ulcers.
PulseChain
What’s new with LL-37
Section B
The quick read
Section C
Research at a glance
A simple picture of the sources we have checked. More color means more records in that category—not that the product works better.
We haven’t added a checked source for this yet.
This picture fills in as we add checked studies for this product.
Section D
What the sources looked at
These topics come only from sources in our record. We do not add a topic just because it is popular online.
No topics yet
Topics show up here once we have checked studies for this product and sorted them.
Section E
Why people look it up
A plain-language starting point. This is not a promise that the product will cause a result.
immune response
See LL-37 beside similar names.
The Portal of Tides lets you switch between a constellation, connection view, checked-source timeline, and topic map. It uses the products already in our collection—no fake customer counts.
Section F
What the record can tell us
A product page can show what was studied. It cannot promise what will happen to a person.
What we can show
No source topic has been added yet.
What we cannot promise
A lab result, animal study, online story, or product page cannot tell you what will happen to you. That question needs qualified medical guidance.
Section G
Claims people make
The big claims tied to this product. Open one to see where it came from and how it spread.
No claims tracked for this product yet
We only add a claim once we can point to where it started, or say clearly that we could not find out.
Section H
How far it has been tested
From cells in a dish, to mice, rats, bigger animals, people, proper trials, and finally regulator approval. The light stops where the checked studies stop.
We have not mapped how far any result has been tested yet.
Section I
How many separate teams
Ten papers from one lab are not ten separate confirmations.
Not checked yet
We only count teams from studies we have confirmed.
Section J
What doesn’t fit?
If a study disagrees, it goes here. We do not hide it.
No study we have checked pushes back yet
Studies that found nothing, disagree, or criticize the method will show up here once we add them. A study that only partly agrees is not the same as one that disagrees.
Section K
Timeline
What happened and when. Studies in one lane, real-world reports in another.
Research
0 events
No dated research update is indexed for this selection.
Trials
0 events
No trial milestones are indexed to this exact record yet.
Regulatory
0 events
No regulator decisions listed yet.
Real-world reports
0 events
No real-world reports yet — social platforms are not connected.
Section L
Sources
Every study we used. Only studies we confirmed on PubMed are shown as sources. Where a drug is FDA-approved, its official label sits beside them — that is an approval, not a sales pitch.
No official FDA label for this product
We only attach an FDA record when the molecule is an approved drug and we have checked the application number. Most research peptides will stay empty here.
We haven’t added a checked source for this yet.
The building blocks, one by one
| # | Code | Residue | Class | Chirality | Features |
|---|---|---|---|---|---|
| 1 | L | Leucine | hydrophobic | L | |
| 2 | L | Leucine | hydrophobic | L | |
| 3 | G | Glycine | special | L | flexible |
| 4 | D | Aspartate | negative | L | |
| 5 | F | Phenylalanine | hydrophobic | L | |
| 6 | F | Phenylalanine | hydrophobic | L | |
| 7 | R | Arginine | positive | L | |
| 8 | K | Lysine | positive | L | |
| 9 | S | Serine | polar | L | |
| 10 | K | Lysine | positive | L | |
| 11 | E | Glutamate | negative | L | |
| 12 | K | Lysine | positive | L | |
| 13 | I | Isoleucine | hydrophobic | L | |
| 14 | G | Glycine | special | L | flexible |
| 15 | K | Lysine | positive | L | |
| 16 | E | Glutamate | negative | L | |
| 17 | F | Phenylalanine | hydrophobic | L | |
| 18 | K | Lysine | positive | L | |
| 19 | R | Arginine | positive | L | |
| 20 | I | Isoleucine | hydrophobic | L | |
| 21 | V | Valine | hydrophobic | L | |
| 22 | Q | Glutamine | polar | L | |
| 23 | R | Arginine | positive | L | |
| 24 | I | Isoleucine | hydrophobic | L | |
| 25 | K | Lysine | positive | L | |
| 26 | D | Aspartate | negative | L | |
| 27 | F | Phenylalanine | hydrophobic | L | |
| 28 | L | Leucine | hydrophobic | L | |
| 29 | R | Arginine | positive | L | |
| 30 | N | Asparagine | polar | L | |
| 31 | L | Leucine | hydrophobic | L | |
| 32 | V | Valine | hydrophobic | L | |
| 33 | P | Proline | special | L | Proline kink |
| 34 | R | Arginine | positive | L | |
| 35 | T | Threonine | polar | L | |
| 36 | E | Glutamate | negative | L | |
| 37 | S | Serine | polar | L |
